General Information

  • ID:  hor007255
  • Uniprot ID:  Q9BT56??28-116)
  • Protein name:  Spexin
  • Gene name:  NA
  • Organism:  Homo sapiens
  • Family:  Spexin family
  • Source:  Animal
  • Expression:  Expressed in the type I glomic cells within the carotid body (at protein level). Expressed predominantly in pancreas; testis; kidney; brain and placenta. Expressed in submucosal layer of esophagus and
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human)
  • GO MF:  GO:0005737 cytoplasm; GO:0031045 dense core granule; GO:0005615 extracellular space; GO:0030133 transport vesicle
  • GO BP:  GO:0005184 neuropeptide hormone activity
  • GO CC:  GO:0003084 positive regulation of systemic arterial blood pressure; GO:0005184; F:neuropeptide hormone activity; IMP:UniProtKB.; GO:0044539 long-chain fatty acid import into cell; GO:0010459 negative regulation of heart rate; GO:0035814 negative regulation of renal sodium excretion; GO:1904306 positive regulation of gastro-intestinal system smooth muscle contraction; GO:0051930 regulation of sensory perception of pain; GO:0032099 negative regulation of appetite

Sequence Information

  • Sequence:  PQRLLERRNWTPQAMLYLKGAQGRRFISDQSRRKDLSDRPLPERRSPNPQLLTIPEAATILLASLQKSPEDEEKNFDQTRFLEDSLLNW
  • Length:  89
  • Propeptide:  MKGLRSLAATTLALFLVFVFLGNSSCAPQRLLERRNWTPQAMLYLKGAQGRRFISDQSRRKDLSDRPLPERRSPNPQLLTIPEAATILLASLQKSPEDEEKNFDQTRFLEDSLLNW
  • Signal peptide:  MKGLRSLAATTLALFLVFVFLGNSSC
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life: Half-Life Yeast:
Half-Life E.Coli: Aliphatic Index
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA